Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF175 Rabbit Polyclonal Antibody (FITC)

ZNF175 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OTK18

UniProt

Q9Y473

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF175

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FSREEWQQLDPAQRCLYRDVMLELYSHLFAVGYHIPNPEVIFRMLKEKEP

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_009078

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Protein Tyrosine Phosphatase Receptor Type N2 (PTPRN2) Antibody Pair Kit (with Standard)
MBS2102609-01 5x 96 Tests

Human Protein Tyrosine Phosphatase Receptor Type N2 (PTPRN2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Protein Tyrosine Phosphatase Receptor Type N2 (PTPRN2) Antibody Pair Kit (with Standard)
MBS2102609-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Protein Tyrosine Phosphatase Receptor Type N2 (PTPRN2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Protein Tyrosine Phosphatase Receptor Type N2 (PTPRN2) Antibody Pair Kit (with Standard)
MBS2102609-03 10x 96 Tests

Human Protein Tyrosine Phosphatase Receptor Type N2 (PTPRN2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Protein Tyrosine Phosphatase Receptor Type N2 (PTPRN2) Antibody Pair Kit (with Standard)
MBS2102609-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Human Protein Tyrosine Phosphatase Receptor Type N2 (PTPRN2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Monoclonal Calbindin D-28K Antibody (FGF2/7365) [PE]
NBP3-24167PE 0.1 mL

Mouse Monoclonal Calbindin D-28K Antibody (FGF2/7365) [PE]

Sign In for Pricing
View Details
PLCZ1 Human shRNA Plasmid Kit (Locus ID 89869)
TL302442 1 Kit

PLCZ1 Human shRNA Plasmid Kit (Locus ID 89869)

Sign In for Pricing
View Details