Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZXDA Rabbit Polyclonal Antibody (Biotin)

ZXDA Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZNF896

UniProt

P98168

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZXDA

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PAKAEWSVHPNSDFFGQEGETQFGFPNAAGNHGSQKERNLITVTGSSFLV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_009087

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MRPL10 Antibody (OTI2B4) [Alexa Fluor 488]
NBP2-72779AF488 0.1 mL

Mouse Monoclonal MRPL10 Antibody (OTI2B4) [Alexa Fluor 488]

Sign In for Pricing
View Details
FAM115A Protein Vector (Mouse) (pPM-C-His)
PV177129 500 ng

FAM115A Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Tight Junction Associated Protein 1, Peripheral (TJAP1)
MBS2136756-01 0.1 mL

APC_Cy7 Linked Polyclonal Antibody to Tight Junction Associated Protein 1, Peripheral (TJAP1)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Tight Junction Associated Protein 1, Peripheral (TJAP1)
MBS2136756-02 0.2 mL

APC_Cy7 Linked Polyclonal Antibody to Tight Junction Associated Protein 1, Peripheral (TJAP1)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Tight Junction Associated Protein 1, Peripheral (TJAP1)
MBS2136756-03 0.5 mL

APC_Cy7 Linked Polyclonal Antibody to Tight Junction Associated Protein 1, Peripheral (TJAP1)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Tight Junction Associated Protein 1, Peripheral (TJAP1)
MBS2136756-04 1 mL

APC_Cy7 Linked Polyclonal Antibody to Tight Junction Associated Protein 1, Peripheral (TJAP1)

Sign In for Pricing
View Details