Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUPT16H Rabbit Polyclonal Antibody (HRP)

SUPT16H Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CDC68, SPT16, FACTP140, SPT16/CDC68

UniProt

Q9Y5B9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SUPT16H

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EESDYSKESLGSEEESGKDWDELEEEARKADRESRYEEEEEQSRSMSRKR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

120kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_009123

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARK3 Antibody, HRP conjugated
CSB-PA013498LB01HU-01 50 µg

MARK3 Antibody, HRP conjugated

Sign In for Pricing
View Details
MARK3 Antibody, HRP conjugated
CSB-PA013498LB01HU-02 100 µg

MARK3 Antibody, HRP conjugated

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-4 Receptor Subunit Alpha (IL4R), C-His
AP2C953-01 1 mg

Recombinant Mouse Interleukin-4 Receptor Subunit Alpha (IL4R), C-His

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-4 Receptor Subunit Alpha (IL4R), C-His
AP2C953-02 10 µg

Recombinant Mouse Interleukin-4 Receptor Subunit Alpha (IL4R), C-His

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-4 Receptor Subunit Alpha (IL4R), C-His
AP2C953-03 50 µg

Recombinant Mouse Interleukin-4 Receptor Subunit Alpha (IL4R), C-His

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-4 Receptor Subunit Alpha (IL4R), C-His
AP2C953-04 500 µg

Recombinant Mouse Interleukin-4 Receptor Subunit Alpha (IL4R), C-His

Sign In for Pricing
View Details