Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZHX1 Rabbit Polyclonal Antibody (Biotin)

ZHX1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9UKY1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PPVLTPVENTRAESISSDEEVHESVDSDNQQNKKVEGGYECKYCTFQTPD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

98kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_009153

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syntaxin 2 (STX2) (NM_194356) Human Over-expression Lysate
LY403665 100 µg

Syntaxin 2 (STX2) (NM_194356) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Lambda Light Chain Mouse Monoclonal Antibody [Clone ID: 1-155-2]
AM26140PU-N 100 µg

Human Lambda Light Chain Mouse Monoclonal Antibody [Clone ID: 1-155-2]

Sign In for Pricing
View Details
ASMTL Rabbit Polyclonal Antibody
TA370244 100 µL

ASMTL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-Thiomorpholinosulfonyl Isatin
TRC-T344565-25MG 25 mg

5-Thiomorpholinosulfonyl Isatin

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: bilateral
CS704219 5x 5 µm

Tissue FFPE Sections, Ovary: bilateral

Sign In for Pricing
View Details
Human Lambda Light Chain Mouse Monoclonal Antibody [Clone ID: HP6054]
AM32827PU-S 100 µg

Human Lambda Light Chain Mouse Monoclonal Antibody [Clone ID: HP6054]

Sign In for Pricing
View Details