Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZHX1 Rabbit Polyclonal Antibody (HRP)

ZHX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9UKY1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PPVLTPVENTRAESISSDEEVHESVDSDNQQNKKVEGGYECKYCTFQTPD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

98kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_009153

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZSCAN22 (Zinc Finger and SCAN Domain Containing 22, HKR2, MGC126679, MGC138482, ZNF50) (Biotin)
253907-Biotin 100 µL

ZSCAN22 (Zinc Finger and SCAN Domain Containing 22, HKR2, MGC126679, MGC138482, ZNF50) (Biotin)

Sign In for Pricing
View Details
Phospho-Src (Tyr418) Rabbit Polyclonal Antibody (BF405)
orb1584417 100 µL

Phospho-Src (Tyr418) Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Donkey anti-Goat IgG (H&L) - Affinity Pure, DyLight650 Conjugate
MBS688276-01 1 mg

Donkey anti-Goat IgG (H&L) - Affinity Pure, DyLight650 Conjugate

Sign In for Pricing
View Details
Donkey anti-Goat IgG (H&L) - Affinity Pure, DyLight650 Conjugate
MBS688276-02 5x 1 mg

Donkey anti-Goat IgG (H&L) - Affinity Pure, DyLight650 Conjugate

Sign In for Pricing
View Details
HOXD9 Antibody, FITC conjugated
MBS7045513-01 0.05 mg

HOXD9 Antibody, FITC conjugated

Sign In for Pricing
View Details
HOXD9 Antibody, FITC conjugated
MBS7045513-02 0.1 mg

HOXD9 Antibody, FITC conjugated

Sign In for Pricing
View Details