Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZHX1 Rabbit Polyclonal Antibody (HRP)

ZHX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9UKY1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PPVLTPVENTRAESISSDEEVHESVDSDNQQNKKVEGGYECKYCTFQTPD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

98kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_009153

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANXA2, NT (Annexin A2, Annexin-2, Annexin II, Lipocortin II, Calpactin I Heavy Chain, Chromobindin-8, p36, Protein I, Placental Anticoagulant Protein IV, PAP-IV, ANX2, ANX2L4, CAL1H, LPC2D) (Biotin)
MBS6463232-01 0.2 mL

ANXA2, NT (Annexin A2, Annexin-2, Annexin II, Lipocortin II, Calpactin I Heavy Chain, Chromobindin-8, p36, Protein I, Placental Anticoagulant Protein IV, PAP-IV, ANX2, ANX2L4, CAL1H, LPC2D) (Biotin)

Sign In for Pricing
View Details
ANXA2, NT (Annexin A2, Annexin-2, Annexin II, Lipocortin II, Calpactin I Heavy Chain, Chromobindin-8, p36, Protein I, Placental Anticoagulant Protein IV, PAP-IV, ANX2, ANX2L4, CAL1H, LPC2D) (Biotin)
MBS6463232-02 5x 0.2 mL

ANXA2, NT (Annexin A2, Annexin-2, Annexin II, Lipocortin II, Calpactin I Heavy Chain, Chromobindin-8, p36, Protein I, Placental Anticoagulant Protein IV, PAP-IV, ANX2, ANX2L4, CAL1H, LPC2D) (Biotin)

Sign In for Pricing
View Details
Human SEZ6L2 siRNA
abx933077-01 15 nmol

Human SEZ6L2 siRNA

Sign In for Pricing
View Details
Human SEZ6L2 siRNA
abx933077-02 30 nmol

Human SEZ6L2 siRNA

Sign In for Pricing
View Details
Crotaline
N1470-100 100 mg

Crotaline

Sign In for Pricing
View Details
PYGB Protein Vector (Mouse) (pPB-N-His)
PV221387 500 ng

PYGB Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details