Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial

Product Specifications

Product Name Alternative

(IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124) (Soluble IL-4 receptor subunit alpha) (Soluble IL-4R-alpha) (sIL4Ralpha/prot) (IL-4-binding protein) (IL4-BP)

Abbreviation

Recombinant Human IL4R protein, partial

Gene Name

IL4R

UniProt

P24394

Expression Region

24-232aa

Organism

Homo sapiens (Human)

Target Sequence

GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2. ; Soluble IL4R (sIL4R) inhibits IL4-mediated cell proliferation and IL5 up-regulation by T-cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

29.9 kDa

References & Citations

"Regulation of the dephosphorylation of Stat6. Participation of Tyr-713 in the interleukin-4 receptor alpha, the tyrosine phosphatase SHP-1, and the proteasome." Hanson E.M., Dickensheets H., Qu C.K., Donnelly R.P., Keegan A.D. J. Biol. Chem. 278:3903-3911 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SARS2 Antibody [Alexa Fluor 350]
NBP2-97631AF350 0.1 mL

Rabbit Polyclonal SARS2 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
SARS-CoV-2 Spike RBD Protein (G485S, His)
MF-0136596-01 5 µg

SARS-CoV-2 Spike RBD Protein (G485S, His)

Sign In for Pricing
View Details
SARS-CoV-2 Spike RBD Protein (G485S, His)
MF-0136596-02 10 µg

SARS-CoV-2 Spike RBD Protein (G485S, His)

Sign In for Pricing
View Details
SARS-CoV-2 Spike RBD Protein (G485S, His)
MF-0136596-03 20 µg

SARS-CoV-2 Spike RBD Protein (G485S, His)

Sign In for Pricing
View Details
SARS-CoV-2 Spike RBD Protein (G485S, His)
MF-0136596-04 50 µg

SARS-CoV-2 Spike RBD Protein (G485S, His)

Sign In for Pricing
View Details
SARS-CoV-2 Spike RBD Protein (G485S, His)
MF-0136596-05 100 µg

SARS-CoV-2 Spike RBD Protein (G485S, His)

Sign In for Pricing
View Details