Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gtf3c3 Rabbit Polyclonal Antibody (Biotin)

Gtf3c3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

D4A7Q9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LGLTHLAIHYYQKALALPPIVVEGIEVDQLDLRRDIAYNMSLIYQSSGNT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001101709

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sec1 Family Domain Containing 1 (SCFD1) Antibody
abx014842-01 10 µg

Sec1 Family Domain Containing 1 (SCFD1) Antibody

Sign In for Pricing
View Details
Sec1 Family Domain Containing 1 (SCFD1) Antibody
abx014842-02 100 µg

Sec1 Family Domain Containing 1 (SCFD1) Antibody

Sign In for Pricing
View Details
Sec1 Family Domain Containing 1 (SCFD1) Antibody
abx014842-03 200 µg

Sec1 Family Domain Containing 1 (SCFD1) Antibody

Sign In for Pricing
View Details
Sec1 Family Domain Containing 1 (SCFD1) Antibody
abx014842-04 300 µg

Sec1 Family Domain Containing 1 (SCFD1) Antibody

Sign In for Pricing
View Details
Sec1 Family Domain Containing 1 (SCFD1) Antibody
abx014842-05 1 mg

Sec1 Family Domain Containing 1 (SCFD1) Antibody

Sign In for Pricing
View Details
Adenylosuccinate Lyase (ADSL) (NM_000026) Human Tagged ORF Clone Lentiviral Particle
RC200524L4V 200 µL

Adenylosuccinate Lyase (ADSL) (NM_000026) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details