Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXB1 Rabbit Polyclonal Antibody (HRP)

FOXB1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FKH5, HFKH-5

UniProt

Q99853

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FOXB1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYY

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036314

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTK1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV710686 1.0 µg DNA

GSTK1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
NR1H2, NT (Oxysterols Receptor LXR-beta, Liver X Receptor beta, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 2, Ubiquitously-expressed Nuclear Receptor, LXRB, NER, UNR) (MaxLight 490)
MBS6269908-01 0.1 mL

NR1H2, NT (Oxysterols Receptor LXR-beta, Liver X Receptor beta, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 2, Ubiquitously-expressed Nuclear Receptor, LXRB, NER, UNR) (MaxLight 490)

Sign In for Pricing
View Details
NR1H2, NT (Oxysterols Receptor LXR-beta, Liver X Receptor beta, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 2, Ubiquitously-expressed Nuclear Receptor, LXRB, NER, UNR) (MaxLight 490)
MBS6269908-02 5x 0.1 mL

NR1H2, NT (Oxysterols Receptor LXR-beta, Liver X Receptor beta, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 2, Ubiquitously-expressed Nuclear Receptor, LXRB, NER, UNR) (MaxLight 490)

Sign In for Pricing
View Details
SLFNL1 Rabbit Polyclonal Antibody (RBITC)
orb1061595 100 µL

SLFNL1 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Mouse Monoclonal UCH-L1/PGP9.5 Antibody (31A3)
NB600-1160-20ug 20 µg

Mouse Monoclonal UCH-L1/PGP9.5 Antibody (31A3)

Sign In for Pricing
View Details
OGFOD2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
32481154 3x 1.0 µg DNA

OGFOD2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details