Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ILF3 Rabbit Polyclonal Antibody (HRP)

ILF3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CBTF, DRBF, MMP4, MPP4, NF90, NFAR, NF110, NF90a, NF90b, NF90c, NFAR2, TCP80, DRBP76, NF110b, NFAR-1, NFAR-2, NFAR90, TCP110, MPP4110, NF90ctv, NFAR110, MPHOSPH4, NF-AT-90

UniProt

Q12906

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ILF3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKG

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_004507

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP9YP26 Protein Vector (Human) (pPM-C-His)
PV142425 500 ng

USP9YP26 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
HIV-1 nef, aa3-190, Recombinant (Human Immunodeficiency Virus-1)
H6004-13F 100 µg

HIV-1 nef, aa3-190, Recombinant (Human Immunodeficiency Virus-1)

Sign In for Pricing
View Details
Lentiviral human PCLAF sgRNA gene knockout kit - Lentiviral human PCLAF sgRNA gene knockout kit (plasmid)
GTR15365546 1 Vial

Lentiviral human PCLAF sgRNA gene knockout kit - Lentiviral human PCLAF sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Anti-CARD9 Picoband® Antibody Fluoro594 Conjugated
A01410-1-Fluoro594 100 µg/Vial

Anti-CARD9 Picoband® Antibody Fluoro594 Conjugated

Sign In for Pricing
View Details
FYB Antibody
MBS8580598-01 0.1 mL

FYB Antibody

Sign In for Pricing
View Details
FYB Antibody
MBS8580598-02 0.1 mL (AF635)

FYB Antibody

Sign In for Pricing
View Details