Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYST4 Rabbit Polyclonal Antibody (Biotin)

MYST4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Qkf, MORF, MOZ2, GTPTS, MYST4, ZC2HC6B, querkopf

UniProt

Q8WYB5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MYST4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQ

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

231kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

AAH48199

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD62P/SELP Antibody Picoband®, FITC Conjugate
PA1715-FITC 100 µg/Vial

Anti-CD62P/SELP Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
TBX10 CRISPR Activation Plasmid (h2)
sc-415640-ACT-2 20 µg

TBX10 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Human Vimentin Baculovirus-Insect cells Overexpression Lysate
MBS8119622-01 0.3 mg

Human Vimentin Baculovirus-Insect cells Overexpression Lysate

Sign In for Pricing
View Details
Human Vimentin Baculovirus-Insect cells Overexpression Lysate
MBS8119622-02 5x 0.3 mg

Human Vimentin Baculovirus-Insect cells Overexpression Lysate

Sign In for Pricing
View Details
Rabbit Monoclonal RNF43 Antibody (077) [Alexa Fluor 532]
NBP2-90325AF532 0.1 mL

Rabbit Monoclonal RNF43 Antibody (077) [Alexa Fluor 532]

Sign In for Pricing
View Details
EphB3 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
19364064 1.0 µg DNA

EphB3 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details