Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RLF Rabbit Polyclonal Antibody (HRP)

RLF Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZN-15L, ZNF292L

UniProt

Q13129

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RLF

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AVAGAGDGVETESMVRGHRPVSPAPGASGLRPCLWQLETELREQEVSEVS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

218kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_036553

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARVELD2 Knockout A549 Polyclonal Cells
ARG10382 1 Million

MARVELD2 Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details
Recombinant human ZDHHC9 Protein, C-His (HEK293)
orb2328389-01 20 µg

Recombinant human ZDHHC9 Protein, C-His (HEK293)

Sign In for Pricing
View Details
Recombinant human ZDHHC9 Protein, C-His (HEK293)
orb2328389-02 50 µg

Recombinant human ZDHHC9 Protein, C-His (HEK293)

Sign In for Pricing
View Details
Recombinant human ZDHHC9 Protein, C-His (HEK293)
orb2328389-03 100 µg

Recombinant human ZDHHC9 Protein, C-His (HEK293)

Sign In for Pricing
View Details
FUT8 (Alpha- (1,6) -fucosyltransferase, Fucosyltransferase 8, GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1,6-fucosyltransferase, GDP-fucose-glycoprotein fucosyltransferase, Glycoprotein 6-alpha-L-fucosyltransferase)
316488 100 µL

FUT8 (Alpha- (1,6) -fucosyltransferase, Fucosyltransferase 8, GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1,6-fucosyltransferase, GDP-fucose-glycoprotein fucosyltransferase, Glycoprotein 6-alpha-L-fucosyltransferase)

Sign In for Pricing
View Details
INHA Antibody (Biotin)
orb238383-01 50 µg

INHA Antibody (Biotin)

Sign In for Pricing
View Details