Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SETDB1 Rabbit Polyclonal Antibody (FITC)

SETDB1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ESET, KG1T, KMT1E, TDRD21, H3-K9-HMTase4

UniProt

Q15047

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SETDB1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDEELEKMDCV

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4921537P18Rik CRISPR/Cas9 KO Plasmid (m)
sc-427849 20 µg

4921537P18Rik CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Human ATP1B1 HEK293 Overexpression Lysate
MBS8115360-01 0.3 mg

Human ATP1B1 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Human ATP1B1 HEK293 Overexpression Lysate
MBS8115360-02 5x 0.3 mg

Human ATP1B1 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
CTSK (Cathepsin K, Cathepsin O, Cathepsin O2, Cathepsin X, CTSO, CTSO2)
309394-01 50 µg

CTSK (Cathepsin K, Cathepsin O, Cathepsin O2, Cathepsin X, CTSO, CTSO2)

Sign In for Pricing
View Details
CTSK (Cathepsin K, Cathepsin O, Cathepsin O2, Cathepsin X, CTSO, CTSO2)
309394-02 100 µg

CTSK (Cathepsin K, Cathepsin O, Cathepsin O2, Cathepsin X, CTSO, CTSO2)

Sign In for Pricing
View Details
Adenosine deaminase domain-containing protein 1
AP79812-01 50 µg

Adenosine deaminase domain-containing protein 1

Sign In for Pricing
View Details