Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SETDB1 Rabbit Polyclonal Antibody (HRP)

SETDB1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ESET, KG1T, KMT1E, TDRD21, H3-K9-HMTase4

UniProt

Q15047

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SETDB1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDEELEKMDCV

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPT1 Lentiviral Activation Particles (h2)
sc-409684-LAC-2 200 µL

NPT1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
MRGPRX2 Antibody, Biotin conjugated
CSB-PA839361LD01HU-01 50 µg

MRGPRX2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
MRGPRX2 Antibody, Biotin conjugated
CSB-PA839361LD01HU-02 100 µg

MRGPRX2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
HOM-TES-103 Antibody - C-terminal region : FITC (ARP55421_P050-FITC)
ARP55421_P050-FITC 100 µL

HOM-TES-103 Antibody - C-terminal region : FITC (ARP55421_P050-FITC)

Sign In for Pricing
View Details
TNFRSF14 Rabbit Polyclonal Antibody (HRP)
orb2616909 100 µg

TNFRSF14 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
E. Coli Lysis Buffer II pH 7.4
22040028-3 1 L

E. Coli Lysis Buffer II pH 7.4

Sign In for Pricing
View Details