Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFAP20 Rabbit Polyclonal Antibody (Biotin)

CFAP20 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GTL3, BUG22, EVORF, fSAP23, C16orf80

UniProt

Q9Y6A4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C16orf80

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_037374

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5,7-Dihydro-5-methyl-6H-dibenz[b, d]azepin-6-one
009825 25 mg

5,7-Dihydro-5-methyl-6H-dibenz[b, d]azepin-6-one

Sign In for Pricing
View Details
CD111, Recombinant, Human, aa31-355, Fc-Tag, Avi-Tag (Biotin)
544183 50 µg

CD111, Recombinant, Human, aa31-355, Fc-Tag, Avi-Tag (Biotin)

Sign In for Pricing
View Details
KIAA1688 Rabbit Polyclonal Antibody (BF594)
orb2494168 100 µL

KIAA1688 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
COXI, ID (MT-CO1, COI, COXI, MTCO1, Cytochrome c oxidase subunit 1, Cytochrome c oxidase polypeptide I) (PE)
MBS6288174-01 0.2 mL

COXI, ID (MT-CO1, COI, COXI, MTCO1, Cytochrome c oxidase subunit 1, Cytochrome c oxidase polypeptide I) (PE)

Sign In for Pricing
View Details
COXI, ID (MT-CO1, COI, COXI, MTCO1, Cytochrome c oxidase subunit 1, Cytochrome c oxidase polypeptide I) (PE)
MBS6288174-02 5x 0.2 mL

COXI, ID (MT-CO1, COI, COXI, MTCO1, Cytochrome c oxidase subunit 1, Cytochrome c oxidase polypeptide I) (PE)

Sign In for Pricing
View Details
Zebrafish VEGF-A ELISA Kit
orb1216508-01 1 set (1 x capture antibody)

Zebrafish VEGF-A ELISA Kit

Sign In for Pricing
View Details