Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPARGC1A Rabbit Polyclonal Antibody (FITC)

PPARGC1A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LEM6, PGC1, PGC1A, PGC-1v, PPARGC1, PGC-1alpha, PGC-1 (alpha)

UniProt

Q9UBK2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PPARGC1A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

91kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_037393

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine 26S proteasome non-ATPase regulatory subunit 13 (PSMD13) ELISA Kit
MBS7214857-01 48 Well

Porcine 26S proteasome non-ATPase regulatory subunit 13 (PSMD13) ELISA Kit

Sign In for Pricing
View Details
Porcine 26S proteasome non-ATPase regulatory subunit 13 (PSMD13) ELISA Kit
MBS7214857-02 96 Well

Porcine 26S proteasome non-ATPase regulatory subunit 13 (PSMD13) ELISA Kit

Sign In for Pricing
View Details
Porcine 26S proteasome non-ATPase regulatory subunit 13 (PSMD13) ELISA Kit
MBS7214857-03 5x 96 Well

Porcine 26S proteasome non-ATPase regulatory subunit 13 (PSMD13) ELISA Kit

Sign In for Pricing
View Details
Porcine 26S proteasome non-ATPase regulatory subunit 13 (PSMD13) ELISA Kit
MBS7214857-04 10x 96 Well

Porcine 26S proteasome non-ATPase regulatory subunit 13 (PSMD13) ELISA Kit

Sign In for Pricing
View Details
Anti-Human IL25/IL17E Antibody (H4H10)
HV984023-01 50 µg

Anti-Human IL25/IL17E Antibody (H4H10)

Sign In for Pricing
View Details
Anti-Human IL25/IL17E Antibody (H4H10)
HV984023-02 100 µg

Anti-Human IL25/IL17E Antibody (H4H10)

Sign In for Pricing
View Details