Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppargc1a Rabbit Polyclonal Antibody (Biotin)

Ppargc1a Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Pgc, Pgc1, PGC-1, Pgco1, Gm11133, Ppargc1, Pgc-1alpha, A830037N07Rik, PPARGC-1-alpha

UniProt

O70343

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LENGYTLRRSNETDFELYFCGRKQFFKSNYADLDTNSDDFDPASTKSKYD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032930

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Polyclonal Antibody to Endothelin 1 (EDN1)
TRV-0022208-01 200 µL

FITC-Linked Polyclonal Antibody to Endothelin 1 (EDN1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Endothelin 1 (EDN1)
TRV-0022208-02 1 mL

FITC-Linked Polyclonal Antibody to Endothelin 1 (EDN1)

Sign In for Pricing
View Details
TRRAP Protein Vector (Human) (pPM-C-His)
PV140701 500 ng

TRRAP Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Human APOL3 Pre-designed siRNA Set B
SI000882B 1 Each

Human APOL3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lentiviral mouse Ttc21a shRNA (UAS) - Lentiviral mouse Ttc21a shRNA (UAS, GFP) (100)
GTR15227565 1 Vial

Lentiviral mouse Ttc21a shRNA (UAS) - Lentiviral mouse Ttc21a shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Rat Vps26c Pre-designed siRNA Set B
SI215827B 1 Each

Rat Vps26c Pre-designed siRNA Set B

Sign In for Pricing
View Details