Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppargc1a Rabbit Polyclonal Antibody (FITC)

Ppargc1a Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Pgc, Pgc1, PGC-1, Pgco1, Gm11133, Ppargc1, Pgc-1alpha, A830037N07Rik, PPARGC-1-alpha

UniProt

O70343

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LENGYTLRRSNETDFELYFCGRKQFFKSNYADLDTNSDDFDPASTKSKYD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032930

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKCSH (G19P1, Glucosidase 2 Subunit beta, 80K-H Protein, Glucosidase II Subunit beta, Protein Kinase C Substrate 60.1kD Protein Heavy Chain) (FITC)
MBS6390750-01 0.1 mL

PRKCSH (G19P1, Glucosidase 2 Subunit beta, 80K-H Protein, Glucosidase II Subunit beta, Protein Kinase C Substrate 60.1kD Protein Heavy Chain) (FITC)

Sign In for Pricing
View Details
PRKCSH (G19P1, Glucosidase 2 Subunit beta, 80K-H Protein, Glucosidase II Subunit beta, Protein Kinase C Substrate 60.1kD Protein Heavy Chain) (FITC)
MBS6390750-02 5x 0.1 mL

PRKCSH (G19P1, Glucosidase 2 Subunit beta, 80K-H Protein, Glucosidase II Subunit beta, Protein Kinase C Substrate 60.1kD Protein Heavy Chain) (FITC)

Sign In for Pricing
View Details
RGD1563917 3'UTR GFP Stable Cell Line
TU268846 1.0 mL

RGD1563917 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human Gap junction alpha-5 protein (GJA5), Fluorescent-VLPs
CSB-MP009448HUf4-01 20 µg

Recombinant Human Gap junction alpha-5 protein (GJA5), Fluorescent-VLPs

Sign In for Pricing
View Details
Recombinant Human Gap junction alpha-5 protein (GJA5), Fluorescent-VLPs
CSB-MP009448HUf4-02 100 µg

Recombinant Human Gap junction alpha-5 protein (GJA5), Fluorescent-VLPs

Sign In for Pricing
View Details
Recombinant Human Gap junction alpha-5 protein (GJA5), Fluorescent-VLPs
CSB-MP009448HUf4-03 1 mg

Recombinant Human Gap junction alpha-5 protein (GJA5), Fluorescent-VLPs

Sign In for Pricing
View Details