Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppargc1a Rabbit Polyclonal Antibody (HRP)

Ppargc1a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Pgc, Pgc1, PGC-1, Pgco1, Gm11133, Ppargc1, Pgc-1alpha, A830037N07Rik, PPARGC-1-alpha

UniProt

O70343

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LENGYTLRRSNETDFELYFCGRKQFFKSNYADLDTNSDDFDPASTKSKYD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032930

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A34 Protein Vector (Human) (pPM-C-HA)
PV038499 500 ng

SLC25A34 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
ALKBH3 Antibody
A64413-50UG 50 µg

ALKBH3 Antibody

Sign In for Pricing
View Details
Human HSD17B1 Recombinant Protein
PPT-13192 100 µg

Human HSD17B1 Recombinant Protein

Sign In for Pricing
View Details
CDK2AP1 Polyclonal Antibody
A53256-100 100 µL

CDK2AP1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Burkholderia cepacia Ribosome maturation factor RimP (rimP)
MBS1213709-01 0.02 mg (E-Coli)

Recombinant Burkholderia cepacia Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details
Recombinant Burkholderia cepacia Ribosome maturation factor RimP (rimP)
MBS1213709-02 0.1 mg (E-Coli)

Recombinant Burkholderia cepacia Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details