Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppargc1a Rabbit Polyclonal Antibody (HRP)

Ppargc1a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Pgc, Pgc1, PGC-1, Pgco1, Gm11133, Ppargc1, Pgc-1alpha, A830037N07Rik, PPARGC-1-alpha

UniProt

O70343

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LENGYTLRRSNETDFELYFCGRKQFFKSNYADLDTNSDDFDPASTKSKYD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032930

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Siglec-2/CD22 Affinity Purified Polyclonal Ab
AF2296-SP 25 µg

Mouse Siglec-2/CD22 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
ELISA kit for Human Lysyl oxidase homolog 4 (LOXL4)
KTE61797-01 48 Tests

ELISA kit for Human Lysyl oxidase homolog 4 (LOXL4)

Sign In for Pricing
View Details
ELISA kit for Human Lysyl oxidase homolog 4 (LOXL4)
KTE61797-02 96 Tests

ELISA kit for Human Lysyl oxidase homolog 4 (LOXL4)

Sign In for Pricing
View Details
ELISA kit for Human Lysyl oxidase homolog 4 (LOXL4)
KTE61797-03 5x 96 Well

ELISA kit for Human Lysyl oxidase homolog 4 (LOXL4)

Sign In for Pricing
View Details
Mouse Monoclonal INSRR/IR-related receptor Antibody (326929) [DyLight 350]
FAB3055D 0.1 mL

Mouse Monoclonal INSRR/IR-related receptor Antibody (326929) [DyLight 350]

Sign In for Pricing
View Details
Mouse BSA-IgE (Bovine serum albumin IgE) ELISA kit
orb2992089-01 48 Tests

Mouse BSA-IgE (Bovine serum albumin IgE) ELISA kit

Sign In for Pricing
View Details