Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Racgap1 Rabbit Polyclonal Antibody (FITC)

Racgap1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

B2GV02

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Racgap1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GPVTTPEFQLVKTPSSNSLSQRLYNLSKSTPRFGNKSKSATNLGQQGKFF

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001101582

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin B Rabbit Polyclonal Antibody (BF405)
orb1604883 100 µL

Cathepsin B Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
5-Hydroxytryptamine Receptor 2C (HTR2C) Antibody
abx126939-01 100 µL

5-Hydroxytryptamine Receptor 2C (HTR2C) Antibody

Sign In for Pricing
View Details
5-Hydroxytryptamine Receptor 2C (HTR2C) Antibody
abx126939-02 200 µL

5-Hydroxytryptamine Receptor 2C (HTR2C) Antibody

Sign In for Pricing
View Details
Lentiviral mouse Ano6 shRNA (UAS) - Lentiviral mouseAno6 shRNA (UAS, GFP) (25)
GTR15195608 1 Vial

Lentiviral mouse Ano6 shRNA (UAS) - Lentiviral mouseAno6 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Mouse monoclonal Anti-Myosin light chains Clone A12
TA353362L 500 µg

Mouse monoclonal Anti-Myosin light chains Clone A12

Sign In for Pricing
View Details
PER3 (Period Circadian Protein Homolog 3, hPER3, Cell Growth-inhibiting Gene 13 Protein, Circadian Clock Protein PERIOD 3, GIG13) (AP) discontinued
131157-AP 100 µL

PER3 (Period Circadian Protein Homolog 3, hPER3, Cell Growth-inhibiting Gene 13 Protein, Circadian Clock Protein PERIOD 3, GIG13) (AP) discontinued

Sign In for Pricing
View Details