Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UHRF1 Rabbit Polyclonal Antibody (HRP)

UHRF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Np95, hNP95, ICBP90, RNF106, TDRD22, hUHRF1, huNp95

UniProt

Q2HIX7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human UHRF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MGVFAVPPLSADTMWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFH

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

91kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_037414

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-E Rabbit pAb
E45R28216N 50 ul

HLA-E Rabbit pAb

Sign In for Pricing
View Details
Wap (NM_053751) Rat Tagged Lenti ORF Clone
RR214612L3 10 µg

Wap (NM_053751) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Equine Interleukin 2 (IL2) ELISA Kit
orb1665442-01 48 Tests

Equine Interleukin 2 (IL2) ELISA Kit

Sign In for Pricing
View Details
Equine Interleukin 2 (IL2) ELISA Kit
orb1665442-02 96 Tests

Equine Interleukin 2 (IL2) ELISA Kit

Sign In for Pricing
View Details
MICA Protein Vector (Human) (pPB-N-His)
PV025934 500 ng

MICA Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Kylt® SE DIVA 1 LD 25
31160 each

Kylt® SE DIVA 1 LD 25

Sign In for Pricing
View Details