Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF112 Rabbit Polyclonal Antibody (HRP)

ZNF112 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZFP112, ZNF228

UniProt

Q0VG01

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF228

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VTFKDVAVVFTEEELGLLDSVQRKLYRDVMLENFRNLLLVAHQPFKPDLI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

105kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_037512

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FAM186B activation kit by CRISPRa
GA113354 1 Kit

Human FAM186B activation kit by CRISPRa

Sign In for Pricing
View Details
PSMD6 Rabbit Polyclonal Antibody
TA380469 100 µL

PSMD6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CMV-p65 (CMV100), CF740 conjugate, 0.1mg/mL
BNC740100-500 1x 500 µL

CMV-p65 (CMV100), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human OR4E1 activation kit by CRISPRa
GA108927 1 Kit

Human OR4E1 activation kit by CRISPRa

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD44 Antibody[HI313]
E-AB-F1329M-01 20 Tests

Elab Fluor® 647 Anti-Human CD44 Antibody[HI313]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD44 Antibody[HI313]
E-AB-F1329M-02 100 Tests

Elab Fluor® 647 Anti-Human CD44 Antibody[HI313]

Sign In for Pricing
View Details