Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REPIN1 Rabbit Polyclonal Antibody (Biotin)

REPIN1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AP4, RIP60, ZNF464, Zfp464

UniProt

Q9BWE0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human REPIN1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGAFCCAICGQTF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_037532

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Fibroblast growth factor 21 (FGF21/UNQ3115/PRO10196) ELISA kit
CSB-E16844h-01 48 Tests

Human Fibroblast growth factor 21 (FGF21/UNQ3115/PRO10196) ELISA kit

Sign In for Pricing
View Details
Human Fibroblast growth factor 21 (FGF21/UNQ3115/PRO10196) ELISA kit
CSB-E16844h-02 96 Tests

Human Fibroblast growth factor 21 (FGF21/UNQ3115/PRO10196) ELISA kit

Sign In for Pricing
View Details
Human Fibroblast growth factor 21 (FGF21/UNQ3115/PRO10196) ELISA kit
CSB-E16844h-03 5x 96 Tests

Human Fibroblast growth factor 21 (FGF21/UNQ3115/PRO10196) ELISA kit

Sign In for Pricing
View Details
Human Fibroblast growth factor 21 (FGF21/UNQ3115/PRO10196) ELISA kit
CSB-E16844h-04 10x 96 Tests

Human Fibroblast growth factor 21 (FGF21/UNQ3115/PRO10196) ELISA kit

Sign In for Pricing
View Details
Human GNRHR Knockout A549 cell line
GTR15417810 1 Vial

Human GNRHR Knockout A549 cell line

Sign In for Pricing
View Details
Monoclonal Antibody to Aryl Hydrocarbon Receptor Nuclear Translocator (ARNT)
MBS2169480-01 0.1 mL

Monoclonal Antibody to Aryl Hydrocarbon Receptor Nuclear Translocator (ARNT)

Sign In for Pricing
View Details