Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zbtb44 Rabbit Polyclonal Antibody (FITC)

Zbtb44 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Btbd15, RGD1308984

UniProt

Q3SWU4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Zbtb44

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VKTFTHSSSSHSQEMLGKLNMLRNDGHFCDITIRVQDRIFRAHKVVLAAC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001030114

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RETN (Resistin, ADSF, FIZZ3, MGC126603, MGC126609, RETN1, RSTN, XCP1) (MaxLight 650)
251052-ML650 100 µL

RETN (Resistin, ADSF, FIZZ3, MGC126603, MGC126609, RETN1, RSTN, XCP1) (MaxLight 650)

Sign In for Pricing
View Details
Tas2r137 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
46171116 3x 1.0 µg

Tas2r137 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Hypodermin-B, Recombinant, Hypoderma lineatum, aa31-256, His-Tag, Myc-Tag
584914-01 20 µg

Hypodermin-B, Recombinant, Hypoderma lineatum, aa31-256, His-Tag, Myc-Tag

Sign In for Pricing
View Details
Hypodermin-B, Recombinant, Hypoderma lineatum, aa31-256, His-Tag, Myc-Tag
584914-02 100 µg

Hypodermin-B, Recombinant, Hypoderma lineatum, aa31-256, His-Tag, Myc-Tag

Sign In for Pricing
View Details
Cdk6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K5034408 1.0 µg DNA

Cdk6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
GKN1 Protein Vector (Mouse) (pPM-C-HA)
PV182172 500 ng

GKN1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details