Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zbtb44 Rabbit Polyclonal Antibody (HRP)

Zbtb44 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Btbd15, RGD1308984

UniProt

Q3SWU4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Zbtb44

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VKTFTHSSSSHSQEMLGKLNMLRNDGHFCDITIRVQDRIFRAHKVVLAAC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001030114

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FOXP3 (Forkhead Box Protein P3) ELISA Kit
E-EL-H1104-01 24 Tests

Human FOXP3 (Forkhead Box Protein P3) ELISA Kit

Sign In for Pricing
View Details
Human FOXP3 (Forkhead Box Protein P3) ELISA Kit
E-EL-H1104-02 48 Tests

Human FOXP3 (Forkhead Box Protein P3) ELISA Kit

Sign In for Pricing
View Details
Human FOXP3 (Forkhead Box Protein P3) ELISA Kit
E-EL-H1104-03 96 Tests

Human FOXP3 (Forkhead Box Protein P3) ELISA Kit

Sign In for Pricing
View Details
CD79b (B-Cell Marker) (rIGB/1842), CF568 conjugate, 0.1mg/mL
BNC683604-100 1x 100 µL

CD79b (B-Cell Marker) (rIGB/1842), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SARS-CoV-2 Spike RBD Protein (S477N, E484K), His Tag (MALS verified)
SPD-C52Hq-100ug 100 µg

SARS-CoV-2 Spike RBD Protein (S477N, E484K), His Tag (MALS verified)

Sign In for Pricing
View Details
RPL32 (NM_001007073) Human Over-expression Lysate
LC423576 20 µg

RPL32 (NM_001007073) Human Over-expression Lysate

Sign In for Pricing
View Details