Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxc11 Rabbit Polyclonal Antibody (Biotin)

Hoxc11 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Hox-3., Hox-3.7

UniProt

P31313

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GADFGERGSCTSNLYLPSCTYYVPEFSTVSSFLPQAPSRQISYPYSAQVP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001020013

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXR2 Antibody
OACA05117-100UG 100 µg

FOXR2 Antibody

Sign In for Pricing
View Details
Signal Transducer And Activator Of Transcription 3 (STAT3) Polyclonal Antibody
CAU29970-01 100 µL

Signal Transducer And Activator Of Transcription 3 (STAT3) Polyclonal Antibody

Sign In for Pricing
View Details
Signal Transducer And Activator Of Transcription 3 (STAT3) Polyclonal Antibody
CAU29970-02 200 µL

Signal Transducer And Activator Of Transcription 3 (STAT3) Polyclonal Antibody

Sign In for Pricing
View Details
Signal Transducer And Activator Of Transcription 3 (STAT3) Polyclonal Antibody
CAU29970-03 1 mL

Signal Transducer And Activator Of Transcription 3 (STAT3) Polyclonal Antibody

Sign In for Pricing
View Details
Acetyl-(D-Phe²,Lys¹⁵,Arg¹⁶,Leu²⁷)-VIP (1-7)-GRF (8-27)
4048647.05 0.5 mg

Acetyl-(D-Phe²,Lys¹⁵,Arg¹⁶,Leu²⁷)-VIP (1-7)-GRF (8-27)

Sign In for Pricing
View Details
Horse C-C Motif Chemokine 2 (CCL2) ELISA Kit
abx585161-01 96 Tests

Horse C-C Motif Chemokine 2 (CCL2) ELISA Kit

Sign In for Pricing
View Details