Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR2E3 Rabbit Polyclonal Antibody (Biotin)

NR2E3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PNR, RNR, rd7, ESCS, RP37

UniProt

Q9Y5X4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NR2E3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: METRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVC

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_055064

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gabrp qPCR Primer Pair
QM55938S 200 Tests

Mouse Gabrp qPCR Primer Pair

Sign In for Pricing
View Details
Volumetric Sol Sodium Hydroxide 0.1M (0.1N) - 10L
S20110 10 L

Volumetric Sol Sodium Hydroxide 0.1M (0.1N) - 10L

Sign In for Pricing
View Details
Madd ORF Vector (Mouse) (pORF)
ORF049639 1.0 µg DNA

Madd ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Human KRT39 Protein, N-His
ARO-P17287-01 50 µg

Recombinant Human KRT39 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human KRT39 Protein, N-His
ARO-P17287-02 100 µg

Recombinant Human KRT39 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human KRT39 Protein, N-His
ARO-P17287-03 1 mg

Recombinant Human KRT39 Protein, N-His

Sign In for Pricing
View Details