Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR2E3 Rabbit Polyclonal Antibody (HRP)

NR2E3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PNR, RNR, rd7, ESCS, RP37

UniProt

Q9Y5X4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NR2E3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: METRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVC

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_055064

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Cdc42 effector protein 1
E14059b 96 Tests

ELISA Kit For Cdc42 effector protein 1

Sign In for Pricing
View Details
SHP2 Antibody
253652 0.1 mg

SHP2 Antibody

Sign In for Pricing
View Details
Mepce sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6636308 1.0 µg DNA

Mepce sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
ANP32B (Acidic Leucine-rich Nuclear Phosphoprotein 32 Family Member B, APRIL, SSP29, PHAPI2, Putative HLA-DR-associated Protein I-2) (APC)
MBS6406532-01 0.1 mL

ANP32B (Acidic Leucine-rich Nuclear Phosphoprotein 32 Family Member B, APRIL, SSP29, PHAPI2, Putative HLA-DR-associated Protein I-2) (APC)

Sign In for Pricing
View Details
ANP32B (Acidic Leucine-rich Nuclear Phosphoprotein 32 Family Member B, APRIL, SSP29, PHAPI2, Putative HLA-DR-associated Protein I-2) (APC)
MBS6406532-02 5x 0.1 mL

ANP32B (Acidic Leucine-rich Nuclear Phosphoprotein 32 Family Member B, APRIL, SSP29, PHAPI2, Putative HLA-DR-associated Protein I-2) (APC)

Sign In for Pricing
View Details
DcR1 Rabbit Polyclonal Antibody (BF405)
orb2458633 100 µL

DcR1 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details