Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR2E3 Rabbit Polyclonal Antibody (HRP)

NR2E3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PNR, RNR, rd7, ESCS, RP37

UniProt

Q8IVZ9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human NR2E3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

XP_011519448.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CX3CL1 Antibody Pair Set
E-KAB-0326 50 µL & 100 µg

Mouse CX3CL1 Antibody Pair Set

Sign In for Pricing
View Details
Recombinant Mucin 5AC Monoclonal Antibody
AN301037L-01 50 µL

Recombinant Mucin 5AC Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Mucin 5AC Monoclonal Antibody
AN301037L-02 100 µL

Recombinant Mucin 5AC Monoclonal Antibody

Sign In for Pricing
View Details
Histone H1 (Pan Nuclear Marker) (rAE-4), CF405S conjugate, 0.1mg/mL
BNC043518-500 1x 500 µL

Histone H1 (Pan Nuclear Marker) (rAE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bromo Polystyrene
H16020009.100G 100 g

Bromo Polystyrene

Sign In for Pricing
View Details
Thomsen-Friedenreich Antigen / CD176 (Pan Carcinoma Marker) (A84-A/F10), 1mg/mL
BNUB1294-500 1x 500 µL

Thomsen-Friedenreich Antigen / CD176 (Pan Carcinoma Marker) (A84-A/F10), 1mg/mL

Sign In for Pricing
View Details