Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBX6 Rabbit Polyclonal Antibody (Biotin)

CBX6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

O95503

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CBX6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SAATSKRAPPEVTAAAGPAPPTAPEPAGASSEPEAGDWRPEMSPCSNVVV

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_055107

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Bovine TNF Receptor-Associated Factor 2 (TRAF2) Monoclonal Antibody
VD12N322 1 Each

Mouse Anti-Bovine TNF Receptor-Associated Factor 2 (TRAF2) Monoclonal Antibody

Sign In for Pricing
View Details
MCAF2, ID (ATF7IP2, MCAF2, Activating transcription factor 7-interacting protein 2, MBD1-containing chromatin-associated factor 2) (MaxLight 405)
MBS6319501-01 0.1 mL

MCAF2, ID (ATF7IP2, MCAF2, Activating transcription factor 7-interacting protein 2, MBD1-containing chromatin-associated factor 2) (MaxLight 405)

Sign In for Pricing
View Details
MCAF2, ID (ATF7IP2, MCAF2, Activating transcription factor 7-interacting protein 2, MBD1-containing chromatin-associated factor 2) (MaxLight 405)
MBS6319501-02 5x 0.1 mL

MCAF2, ID (ATF7IP2, MCAF2, Activating transcription factor 7-interacting protein 2, MBD1-containing chromatin-associated factor 2) (MaxLight 405)

Sign In for Pricing
View Details
Feline IL31 Protein, His Tag
32-18519-100 100 µg

Feline IL31 Protein, His Tag

Sign In for Pricing
View Details
NOG (Noggin, Symphalangism 1 (proximal), SYM1, SYNS1)
207820 100 µg

NOG (Noggin, Symphalangism 1 (proximal), SYM1, SYNS1)

Sign In for Pricing
View Details
NFIX Antibody; HRP conjugated
MBS7003045-01 0.05 mg

NFIX Antibody; HRP conjugated

Sign In for Pricing
View Details