Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBX6 Rabbit Polyclonal Antibody (FITC)

CBX6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

O95503

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CBX6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SAATSKRAPPEVTAAAGPAPPTAPEPAGASSEPEAGDWRPEMSPCSNVVV

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_055107

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Macrophage Migration Inhibitory Factor (MIF, GIF, GLIF, MMIF, MIF) (HRP)
MBS6425136-01 0.1 mL

Macrophage Migration Inhibitory Factor (MIF, GIF, GLIF, MMIF, MIF) (HRP)

Sign In for Pricing
View Details
Macrophage Migration Inhibitory Factor (MIF, GIF, GLIF, MMIF, MIF) (HRP)
MBS6425136-02 5x 0.1 mL

Macrophage Migration Inhibitory Factor (MIF, GIF, GLIF, MMIF, MIF) (HRP)

Sign In for Pricing
View Details
Anti-Fruit fly Trpgamma Antibody Fluoro550 Conjugated
DZ41156-Fluoro550 200 µL/Vial

Anti-Fruit fly Trpgamma Antibody Fluoro550 Conjugated

Sign In for Pricing
View Details
Human PRDM1 Knockout A549 cell line
GTR15408090 1 Vial

Human PRDM1 Knockout A549 cell line

Sign In for Pricing
View Details
Difucosyl-para-lacto-N-hexaose II
OD02518-01 250 µg

Difucosyl-para-lacto-N-hexaose II

Sign In for Pricing
View Details
Difucosyl-para-lacto-N-hexaose II
OD02518-02 500 µg

Difucosyl-para-lacto-N-hexaose II

Sign In for Pricing
View Details