Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBX6 Rabbit Polyclonal Antibody (FITC)

CBX6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

O95503

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CBX6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SAATSKRAPPEVTAAAGPAPPTAPEPAGASSEPEAGDWRPEMSPCSNVVV

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_055107

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C4BPB Antibody
CSB-PA003954ESR1HU-01 50 μL

C4BPB Antibody

Sign In for Pricing
View Details
C4BPB Antibody
CSB-PA003954ESR1HU-02 100 µL

C4BPB Antibody

Sign In for Pricing
View Details
TLE4, ID (TLE4, KIAA1261, Transducin-like enhancer protein 4) (Biotin) discontinued
031295-Biotin 100 µL

TLE4, ID (TLE4, KIAA1261, Transducin-like enhancer protein 4) (Biotin) discontinued

Sign In for Pricing
View Details
Olig3 (Oligodendrocyte Transcription Factor 3, Oligo3, Class B basic Helix-Loop-Helix Protein 7, bHLHb7, Oligodendrocyte-specific bHLH Transcription Factor 3, Olig3, Bhlhb7) (MaxLight 405) discontinued
302617-ML405 100 µL

Olig3 (Oligodendrocyte Transcription Factor 3, Oligo3, Class B basic Helix-Loop-Helix Protein 7, bHLHb7, Oligodendrocyte-specific bHLH Transcription Factor 3, Olig3, Bhlhb7) (MaxLight 405) discontinued

Sign In for Pricing
View Details
ExoPure? Reagent (Overall Exosome Isolation, cell media)
M1002-50 each

ExoPure? Reagent (Overall Exosome Isolation, cell media)

Sign In for Pricing
View Details
Animal-Free IL-17B, Human (His)
HY-P700105AF-01 2 µg

Animal-Free IL-17B, Human (His)

Sign In for Pricing
View Details