Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF1B2, Human (His)

EEF1B2 Protein facilitates GDP-to-GTP exchange on EEF1A Protein, driving the conversion. EEF1 comprises four subunits: alpha, beta, delta, and gamma. EEF1B2 Protein, Human (His) is the recombinant human-derived EEF1B2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

EEF1B2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eef1b2-protein-human-his.html

Purity

94.20

Smiles

GFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI

Molecular Formula

1933 (Gene_ID) P24534 (G2-I225) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCAG-3xFLAG-PTGER3 (human) -EGFP-StrepII
BZ57058 1 Vial

PCAG-3xFLAG-PTGER3 (human) -EGFP-StrepII

Sign In for Pricing
View Details
SPOCK3 Recombinant Protein (Human)
RP029959 100 µg

SPOCK3 Recombinant Protein (Human)

Sign In for Pricing
View Details
Synpo2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6478705 3x 1.0 µg

Synpo2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
LOC541469 (NM_001013617) Human Over-expression Lysate
LS541469-100ug 100 µg

LOC541469 (NM_001013617) Human Over-expression Lysate

Sign In for Pricing
View Details
ANKRD34A Lentiviral Activation Particles (h2)
sc-415397-LAC-2 200 µL

ANKRD34A Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
USP40 CRISPR Activation Plasmid (h2)
sc-408036-ACT-2 20 µg

USP40 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details