Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF1B2, Human (His)

EEF1B2 Protein facilitates GDP-to-GTP exchange on EEF1A Protein, driving the conversion. EEF1 comprises four subunits: alpha, beta, delta, and gamma. EEF1B2 Protein, Human (His) is the recombinant human-derived EEF1B2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

EEF1B2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eef1b2-protein-human-his.html

Purity

94.20

Smiles

GFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI

Molecular Formula

1933 (Gene_ID) P24534 (G2-I225) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Devardas Alloy (45% Al, 50% Cu, 5% Zn) extrapure
93995-01 100 g

Devardas Alloy (45% Al, 50% Cu, 5% Zn) extrapure

Sign In for Pricing
View Details
Devardas Alloy (45% Al, 50% Cu, 5% Zn) extrapure
93995-02 500 g

Devardas Alloy (45% Al, 50% Cu, 5% Zn) extrapure

Sign In for Pricing
View Details
Recombinant Staphylococcus carnosus DNA mismatch repair protein MutS (mutS), partial
MBS1032752 Inquire

Recombinant Staphylococcus carnosus DNA mismatch repair protein MutS (mutS), partial

Sign In for Pricing
View Details
Klra10 ORF Vector (Mouse) (pORF)
ORF048725 1.0 µg DNA

Klra10 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Procollagen I N-Terminal Propeptide (PINP)
MBS2108181-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Procollagen I N-Terminal Propeptide (PINP)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Procollagen I N-Terminal Propeptide (PINP)
MBS2108181-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Procollagen I N-Terminal Propeptide (PINP)

Sign In for Pricing
View Details