Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYBBP1A Rabbit Polyclonal Antibody (Biotin)

MYBBP1A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P160, PAP2, Pol5

UniProt

Q9BQG0

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence SRDPAQPMSPGEATQSGARPADRYGLLKHSREFLDFFWDIAKPEQETRLA

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SRDPAQPMSPGEATQSGARPADRYGLLKHSREFLDFFWDIAKPEQETRLA

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

149 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

NCBI Accession Number

NP_055335

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Avibactam sodium
9569-5 5 mg

Avibactam sodium

Sign In for Pricing
View Details
Lentiviral human KIZ shRNA (UAS) - Lentiviral human KIZ shRNA (UAS, RFP) (100)
GTR15121908 1 Vial

Lentiviral human KIZ shRNA (UAS) - Lentiviral human KIZ shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Anti-MOGAT2 Antibody Picoband®, iFluor647 Conjugate
A10993-2-iFluor647 100 µg

Anti-MOGAT2 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
PTPN7 (S44) (Tyrosine-protein Phosphatase Non-receptor Type 7, Protein-tyrosine Phosphatase LC-PTP, Hematopoietic Protein-tyrosine Phosphatase, HEPTP) (Azide free) (HRP) discontinued
P9109-28N-HRP 200 µL

PTPN7 (S44) (Tyrosine-protein Phosphatase Non-receptor Type 7, Protein-tyrosine Phosphatase LC-PTP, Hematopoietic Protein-tyrosine Phosphatase, HEPTP) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Mouse Lymphocyte antibody (FITC)
60R-LR003FT 2 mg

Mouse Lymphocyte antibody (FITC)

Sign In for Pricing
View Details
MMP8 (CLG1) discontinued
511596 100 µg

MMP8 (CLG1) discontinued

Sign In for Pricing
View Details