Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYBBP1A Rabbit Polyclonal Antibody (FITC)

MYBBP1A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P160, PAP2, Pol5

UniProt

Q9BQG0

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence SRDPAQPMSPGEATQSGARPADRYGLLKHSREFLDFFWDIAKPEQETRLA

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SRDPAQPMSPGEATQSGARPADRYGLLKHSREFLDFFWDIAKPEQETRLA

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

149 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

NCBI Accession Number

NP_055335

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse GHb ELISA Kit
E110271 1 Each

Mouse GHb ELISA Kit

Sign In for Pricing
View Details
Importin alpha-3 (KPNA4) Antibody (C-term) Rabbit Polyclonal Antibody
E10G30174 100 µL

Importin alpha-3 (KPNA4) Antibody (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal SETDB1 Antibody [DyLight 755]
NB100-79776IR 0.1 mL

Rabbit Polyclonal SETDB1 Antibody [DyLight 755]

Sign In for Pricing
View Details
Juxtanodin (JN) Magnetic Fluorescence Assay Kit
MBS2161590-01 96 Tests

Juxtanodin (JN) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Juxtanodin (JN) Magnetic Fluorescence Assay Kit
MBS2161590-02 5x 96 Tests

Juxtanodin (JN) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Juxtanodin (JN) Magnetic Fluorescence Assay Kit
MBS2161590-03 10x 96 Tests

Juxtanodin (JN) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details