Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYBBP1A Rabbit Polyclonal Antibody (HRP)

MYBBP1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P160, PAP2, Pol5

UniProt

Q9BQG0

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence SRDPAQPMSPGEATQSGARPADRYGLLKHSREFLDFFWDIAKPEQETRLA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SRDPAQPMSPGEATQSGARPADRYGLLKHSREFLDFFWDIAKPEQETRLA

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

149 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

NCBI Accession Number

NP_055335

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A42 Human qPCR Primer Pair (NM_178526)
HP218854 200 Reactions

SLC25A42 Human qPCR Primer Pair (NM_178526)

Sign In for Pricing
View Details
RUNX2 Polyclonal Antibody
D-AB-10450L-01 25 µL

RUNX2 Polyclonal Antibody

Sign In for Pricing
View Details
RUNX2 Polyclonal Antibody
D-AB-10450L-02 100 µL

RUNX2 Polyclonal Antibody

Sign In for Pricing
View Details
PDGFC Rabbit Polyclonal Antibody
TA367181 100 µL

PDGFC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Myosin Light Chain 2 (MYL2) (1-166) Mouse Monoclonal Antibody [Clone ID: AT3B2]
AM09080PU-S 50 µL

Myosin Light Chain 2 (MYL2) (1-166) Mouse Monoclonal Antibody [Clone ID: AT3B2]

Sign In for Pricing
View Details
TRIM5 alpha (TRIM5) Rabbit Polyclonal Antibody
AP07798PU-N 50 µg

TRIM5 alpha (TRIM5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details