Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTX1 Rabbit Polyclonal Antibody (Biotin)

OTX1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

P32242

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OTX1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HHQGYGGSGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASW

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055377

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ubiquitin Specific Peptidase 14 (USP14) ELISA Kit
DLR-USP14-Hu-48T 48 Tests

Human Ubiquitin Specific Peptidase 14 (USP14) ELISA Kit

Sign In for Pricing
View Details
Rat Sybu Pre-designed siRNA Set B
SI214041B 1 Each

Rat Sybu Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit Anti-ZN800/ZNF800 Polyclonal Antibody
PAV4522 100 μL

Rabbit Anti-ZN800/ZNF800 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Chaperonin Containing TCP1, Subunit 2 (CCT2) ELISA Kit
TRV-0002972 96 Well Plate

Mouse Chaperonin Containing TCP1, Subunit 2 (CCT2) ELISA Kit

Sign In for Pricing
View Details
Goat Pulmonary Activation Regulated Chemokine ELISA Kit
MBS742384-01 48 Well

Goat Pulmonary Activation Regulated Chemokine ELISA Kit

Sign In for Pricing
View Details
Goat Pulmonary Activation Regulated Chemokine ELISA Kit
MBS742384-02 96 Well

Goat Pulmonary Activation Regulated Chemokine ELISA Kit

Sign In for Pricing
View Details