Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXXC1 Rabbit Polyclonal Antibody (Biotin)

CXXC1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CFP1, CGBP, SPP1, PCCX1, PHF18, hCGBP, ZCGPC1, HsT2645, 2410002I16Rik, 5830420C16Rik

UniProt

Q9P0U4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CXXC1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPLTTDLRSSADR

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055408

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL1F10 Mouse Monoclonal
MBS7600469-01 0.1 mg

IL1F10 Mouse Monoclonal

Sign In for Pricing
View Details
IL1F10 Mouse Monoclonal
MBS7600469-02 5x 0.1 mg

IL1F10 Mouse Monoclonal

Sign In for Pricing
View Details
MRPS21P5 CRISPRa sgRNA lentivector (set of three targets)(Human)
30558121 3x 1.0µg DNA

MRPS21P5 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Lentiviral human LIPI shRNA (UAS) - Lentiviral human LIPI shRNA (UAS, RFP) (25)
GTR15105803 1 Vial

Lentiviral human LIPI shRNA (UAS) - Lentiviral human LIPI shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
KHDC1L (NM_001126063) Human Tagged Lenti ORF Clone
RC225082L3 10 µg

KHDC1L (NM_001126063) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TNFSF11 Antibody
orb1272306 0.1 mg

TNFSF11 Antibody

Sign In for Pricing
View Details