Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXXC1 Rabbit Polyclonal Antibody (Biotin)

CXXC1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CFP1, CGBP, SPP1, PCCX1, PHF18, hCGBP, ZCGPC1, HsT2645, 2410002I16Rik, 5830420C16Rik

UniProt

Q9P0U4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CXXC1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPLTTDLRSSADR

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055408

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPM2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
18539154 3x 1.0 µg DNA

DPM2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
NFAT2 (NFATC1) (NM_006162) Human Tagged Lenti ORF Clone
RC212692L4 10 µg

NFAT2 (NFATC1) (NM_006162) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Quinoline Yellow (C.I. 47000)
GT7040-250g 250 g

Quinoline Yellow (C.I. 47000)

Sign In for Pricing
View Details
Tantalum (V) chloride, resublimed
IN3406-01 25 g

Tantalum (V) chloride, resublimed

Sign In for Pricing
View Details
Tantalum (V) chloride, resublimed
IN3406-02 100 g

Tantalum (V) chloride, resublimed

Sign In for Pricing
View Details
NA Protein (N-His, H4N6)
P526943 100 µg

NA Protein (N-His, H4N6)

Sign In for Pricing
View Details