Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXXC1 Rabbit Polyclonal Antibody (HRP)

CXXC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CFP1, CGBP, SPP1, PCCX1, PHF18, hCGBP, ZCGPC1, HsT2645, 2410002I16Rik, 5830420C16Rik

UniProt

Q9P0U4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CXXC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPLTTDLRSSADR

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055408

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human/Mouse VEGFC Recombinant Rabbit monoclonal Antibody
HA723241 100 µL

Human/Mouse VEGFC Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR560458 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
1-Phenylcyclohexylamine Hydrochloride
TRC-P319960-5MG 5 mg

1-Phenylcyclohexylamine Hydrochloride

Sign In for Pricing
View Details
THNSL1 Polyclonal Antibody
E-AB-52858-01 20 µL

THNSL1 Polyclonal Antibody

Sign In for Pricing
View Details
THNSL1 Polyclonal Antibody
E-AB-52858-02 60 µL

THNSL1 Polyclonal Antibody

Sign In for Pricing
View Details
THNSL1 Polyclonal Antibody
E-AB-52858-03 120 µL

THNSL1 Polyclonal Antibody

Sign In for Pricing
View Details