Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXXC1 Rabbit Polyclonal Antibody (HRP)

CXXC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CFP1, CGBP, SPP1, PCCX1, PHF18, hCGBP, ZCGPC1, HsT2645, 2410002I16Rik, 5830420C16Rik

UniProt

Q9P0U4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CXXC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPLTTDLRSSADR

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055408

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STK39 Antibody
8C18954-AAT 50 µg

STK39 Antibody

Sign In for Pricing
View Details
CD229 (LY9) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H4]
TA811828BM 100 µL

CD229 (LY9) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H4]

Sign In for Pricing
View Details
Recombinant Human CDH1 Protein (Trx Tag)
PDEH100501-01 20 µg

Recombinant Human CDH1 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human CDH1 Protein (Trx Tag)
PDEH100501-02 100 µg

Recombinant Human CDH1 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human CDH1 Protein (Trx Tag)
PDEH100501-03 500 µg

Recombinant Human CDH1 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human CDH1 Protein (Trx Tag)
PDEH100501-04 1 mg

Recombinant Human CDH1 Protein (Trx Tag)

Sign In for Pricing
View Details