Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXD4 Rabbit Polyclonal Antibody (Biotin)

HOXD4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HOX4, HOX4B, HHO.C13, HOX-5.1, Hox-4.2

UniProt

P09016

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HOXD4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055436

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ABCA4 ELISA Kit (Ready to Use)
orb549927-01 48 Tests

Human ABCA4 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Human ABCA4 ELISA Kit (Ready to Use)
orb549927-02 96 Tests

Human ABCA4 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
MAGP-2 Double Nickase Plasmid (h2)
sc-408785-NIC-2 20 µg

MAGP-2 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Horse Adrenocorticotropic Hormone (ACTH) ELISA Kit
SL0022Ho-01 48 Tests

Horse Adrenocorticotropic Hormone (ACTH) ELISA Kit

Sign In for Pricing
View Details
Horse Adrenocorticotropic Hormone (ACTH) ELISA Kit
SL0022Ho-02 96 Tests

Horse Adrenocorticotropic Hormone (ACTH) ELISA Kit

Sign In for Pricing
View Details
6-Oxa-1-azaspiro[3.5]nonane hydrochloride
GDD32437-01 10 mg

6-Oxa-1-azaspiro[3.5]nonane hydrochloride

Sign In for Pricing
View Details