Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXD4 Rabbit Polyclonal Antibody (HRP)

HOXD4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HOX4, HOX4B, HHO.C13, HOX-5.1, Hox-4.2

UniProt

P09016

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HOXD4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055436

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-(3’,4’-Dichlorophenyl)-3,4-dihydro-2H-naphthalen-1-one Oxime
TRC-D435710-50MG 50 mg

4-(3’,4’-Dichlorophenyl)-3,4-dihydro-2H-naphthalen-1-one Oxime

Sign In for Pricing
View Details
Ethyl Paraben
TRC-E925475-1G 1 g

Ethyl Paraben

Sign In for Pricing
View Details
SULT2B1 (N-term) Rabbit Polyclonal Antibody
AP12292PU-N 400 µL

SULT2B1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Occludin (Marker of Early Blood Brain Barrier Damage) (OCLN/2181), CF488A conjugate, 0.1mg/mL
BNC882181-100 1x 100 µL

Occludin (Marker of Early Blood Brain Barrier Damage) (OCLN/2181), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
p-Cyanobenzoic Acid Trimer
TRC-C955200-500MG 500 mg

p-Cyanobenzoic Acid Trimer

Sign In for Pricing
View Details
Human SLC38A7 activation kit by CRISPRa
GA110633 1 Kit

Human SLC38A7 activation kit by CRISPRa

Sign In for Pricing
View Details