Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SART3 Rabbit Polyclonal Antibody (Biotin)

SART3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P100, p110, DSAP1, TIP110, p110 (nrb), RP11-13G14

UniProt

Q15020

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SART3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TSASEPEAESKAGPKADGEEDEVKAARTRRKVLSRAVAAATYKTMGPAWD

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Porcine, Rat

Tested Applications

IHC, WB

NCBI Accession Number

AAK69347

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOSL2 (FOS-like antigen 2, FLJ23306, FRA2) (FITC)
MBS6176753-01 0.1 mL

FOSL2 (FOS-like antigen 2, FLJ23306, FRA2) (FITC)

Sign In for Pricing
View Details
FOSL2 (FOS-like antigen 2, FLJ23306, FRA2) (FITC)
MBS6176753-02 5x 0.1 mL

FOSL2 (FOS-like antigen 2, FLJ23306, FRA2) (FITC)

Sign In for Pricing
View Details
Fluorescein Conjugated Affinity Purified anti-Chicken IgG [H&L] [Goat]
MBS417892-01 0.25 mg

Fluorescein Conjugated Affinity Purified anti-Chicken IgG [H&L] [Goat]

Sign In for Pricing
View Details
Fluorescein Conjugated Affinity Purified anti-Chicken IgG [H&L] [Goat]
MBS417892-02 5x 0.25 mg

Fluorescein Conjugated Affinity Purified anti-Chicken IgG [H&L] [Goat]

Sign In for Pricing
View Details
Ccdc24 (NM_001134626) Rat Tagged Lenti ORF Clone
RR208617L4 10 µg

Ccdc24 (NM_001134626) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CRSP8 (MED27) Human shRNA Plasmid Kit (Locus ID 9442)
TL313720 1 Kit

CRSP8 (MED27) Human shRNA Plasmid Kit (Locus ID 9442)

Sign In for Pricing
View Details