Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOX4 Rabbit Polyclonal Antibody (HRP)

TOX4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LCP1, MIG7, C14orf92, KIAA0737

UniProt

B4DPY8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human TOX4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RCVRSGCENPPIVSKDWDNEYCSNECVVKHCRDVFLAWVASRNSNTVVFV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001290452.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lestaurtinib (CEP701), JAK2, FLT3, and TrkA tyrosine kinase inhibitor
TBI2149-1MG 1 mg

Lestaurtinib (CEP701), JAK2, FLT3, and TrkA tyrosine kinase inhibitor

Sign In for Pricing
View Details
IL6R (Interleukin-6 Receptor Subunit alpha, IL-6 Receptor Subunit alpha, IL-6R Subunit alpha, IL-6R-alpha, IL-6RA, IL-6R 1, Membrane Glycoprotein 80, gp80, CD126, MGC104991) (PE)
128476-PE 100 µL

IL6R (Interleukin-6 Receptor Subunit alpha, IL-6 Receptor Subunit alpha, IL-6R Subunit alpha, IL-6R-alpha, IL-6RA, IL-6R 1, Membrane Glycoprotein 80, gp80, CD126, MGC104991) (PE)

Sign In for Pricing
View Details
Anti-GABAA Receptor a 4, antibody
STJ120289 100 µl

Anti-GABAA Receptor a 4, antibody

Sign In for Pricing
View Details
RPS27P14 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV784785 1.0 µg DNA

RPS27P14 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Human Hematopoietic Prostaglandin D Synthase (HPGDS) ELISA Kit
abx351066-01 96 Tests

Human Hematopoietic Prostaglandin D Synthase (HPGDS) ELISA Kit

Sign In for Pricing
View Details
Human Hematopoietic Prostaglandin D Synthase (HPGDS) ELISA Kit
abx351066-02 5x 96 Tests

Human Hematopoietic Prostaglandin D Synthase (HPGDS) ELISA Kit

Sign In for Pricing
View Details