Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF510 Rabbit Polyclonal Antibody (HRP)

ZNF510 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KIAA0972, MGC33740

UniProt

Q9Y2H8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF510

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RKAILSDHQRIHTGEKPFQCNKCGKTFGQKSNLRIHQRTHSGEKSYECNE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055745

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Erythropoietin alpha (human), (recombinant)
MBS565855-01 500 Units

Erythropoietin alpha (human), (recombinant)

Sign In for Pricing
View Details
Erythropoietin alpha (human), (recombinant)
MBS565855-02 5x 500 Units

Erythropoietin alpha (human), (recombinant)

Sign In for Pricing
View Details
Vortioxetine Impurity 25
CS-P-01761 1 Each

Vortioxetine Impurity 25

Sign In for Pricing
View Details
TLR1 Recombinant Protein
OPCD07486-50UG 50 µg

TLR1 Recombinant Protein

Sign In for Pricing
View Details
Plasma Protease C1 Inhibitor (SERPING1) Rabbit ELISA Kit
F9319 96 Tests

Plasma Protease C1 Inhibitor (SERPING1) Rabbit ELISA Kit

Sign In for Pricing
View Details
FBP1, NT (Fructose-1,6-bisphosphatase 1, FBPase 1, D-fructose-1,6-bisphosphate 1-phosphohydrolase 1, FBP) (MaxLight 650)
MBS6477015-01 0.1 mL

FBP1, NT (Fructose-1,6-bisphosphatase 1, FBPase 1, D-fructose-1,6-bisphosphate 1-phosphohydrolase 1, FBP) (MaxLight 650)

Sign In for Pricing
View Details