Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM35 Rabbit Polyclonal Antibody (HRP)

TRIM35 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HLS5, MAIR

UniProt

Q9UPQ4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM35

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RTQGVEGDHCVTSDPATSPLVLAIPRRLRVELECEEGELSFYDAERHCHL

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_055881

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VWF Blocking Peptide
MBS9633359-01 1 mg

VWF Blocking Peptide

Sign In for Pricing
View Details
VWF Blocking Peptide
MBS9633359-02 5x 1 mg

VWF Blocking Peptide

Sign In for Pricing
View Details
Lyplal1 3'UTR GFP Stable Cell Line
TU162747 1.0 mL

Lyplal1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei Probable transcriptional regulatory protein BURPS1106A_1240 (BURPS1106A_1240)
MBS1189808-01 0.02 mg (E-Coli)

Recombinant Burkholderia pseudomallei Probable transcriptional regulatory protein BURPS1106A_1240 (BURPS1106A_1240)

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei Probable transcriptional regulatory protein BURPS1106A_1240 (BURPS1106A_1240)
MBS1189808-02 0.1 mg (E-Coli)

Recombinant Burkholderia pseudomallei Probable transcriptional regulatory protein BURPS1106A_1240 (BURPS1106A_1240)

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei Probable transcriptional regulatory protein BURPS1106A_1240 (BURPS1106A_1240)
MBS1189808-03 0.02 mg (Yeast)

Recombinant Burkholderia pseudomallei Probable transcriptional regulatory protein BURPS1106A_1240 (BURPS1106A_1240)

Sign In for Pricing
View Details