Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIC2 Rabbit Polyclonal Antibody (FITC)

HIC2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HRG22, ZBTB30, ZNF907

UniProt

Q96JB3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HIC2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FACDECGMRFTRQYRLTEHMRVHSGEKPYECQLCGGKFTQQRNLISHLRM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055909

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIT, phosphorylated (T354) (KIT, SCFR, Mast/stem cell growth factor receptor Kit, Piebald trait protein, Proto-oncogene c-Kit, Tyrosine-protein kinase Kit, p145 c-kit, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, CD117) (Biotin) discontinued
037501-Biotin 200 µL

KIT, phosphorylated (T354) (KIT, SCFR, Mast/stem cell growth factor receptor Kit, Piebald trait protein, Proto-oncogene c-Kit, Tyrosine-protein kinase Kit, p145 c-kit, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, CD117) (Biotin) discontinued

Sign In for Pricing
View Details
Anti-IFITM3 Antibody (FITC)
STJ501406 100 µg

Anti-IFITM3 Antibody (FITC)

Sign In for Pricing
View Details
COTL1P2 3'UTR GFP Stable Cell Line
TU054862 1.0 mL

COTL1P2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RANBP3 (NM_007320) Human Over-expression Lysate
E45H08614-2 20 µg

RANBP3 (NM_007320) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Monoclonal Fc gamma RIII (CD16) Antibody (MEM-154) [DyLight 350]
NB500-378UV 0.1 mL

Mouse Monoclonal Fc gamma RIII (CD16) Antibody (MEM-154) [DyLight 350]

Sign In for Pricing
View Details
RASSF3 Antibody, Biotin conjugated
A60517-100UG 100 µg

RASSF3 Antibody, Biotin conjugated

Sign In for Pricing
View Details